LRRC10 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LRRC10 Antibody is: synthetic peptide directed towards the C-terminal region of Human LRRC10. Synthetic peptide located within the following region: PKVAKGVRRVGRWAEETPEPDPRKARRYALVREESQELQAPVPLLPPTNS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	leucine rich repeat containing 10
Database Link	NP_963844 Entrez Gene 376132 Human UniProt ID Q5BKY1
Background	LRRC10 may play important roles in cardiac development and/or cardiac function.
Synonyms	HRLRRP; LRRC10A
Note	Immunogen sequence homology: Human: 100%; Rabbit: 91%; Bovine: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.