IGFL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-IGFL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human IGFL2. Synthetic peptide located within the following region: QCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCES
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	14 kDa
Gene Name	IGF like family member 2
Database Link	NP_001002915 Entrez Gene 147920 Human UniProt ID Q6UWQ7
Background	IGFL2 belongs to the insulin-like growth factor family of signaling molecules that play critical roles in cellular energy metabolism and in growth and development, especially prenatal growth.
Synonyms	UNQ645; VPRI645
Note	Immunogen sequence homology: Human: 100%; Rabbit: 92%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.