EFTUD1 (EFL1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-EFTUD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human EFTUD1. Synthetic peptide located within the following region: TTEEEYLHFGEKADSENQARKYMNAVRKRKGLYVEEKIVEHAEKQRTLSK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	117 kDa
Gene Name	elongation factor like GTPase 1
Database Link	NP_001035700 Entrez Gene 79631 Human UniProt ID Q7Z2Z2
Background	EFTUD1 is involved in the biogenesis of the 60S ribosomal subunit and translational activation of ribosomes. Together with SBDS, EFTUD1 triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. EFTUD1 has low intrinsic GTPase activity. GTPase activity is increased by contact with 60S ribosome subunits.
Synonyms	EFTUD1; FAM42A; HsT19294; RIA1
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.