C12orf56 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C12orf56 Antibody is: synthetic peptide directed towards the N-terminal region of Human C12orf56. Synthetic peptide located within the following region: RDVVAIDLIDDYPEFLSSPDREISQHIRIIYSSTVLKKECKKSNSVRKFL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	chromosome 12 open reading frame 56
Database Link	NP_001093146 Entrez Gene 115749 Human UniProt ID Q8IXR9
Background	The function of this protein remains unknown.
Synonyms	C12orf56
Note	Immunogen sequence homology: Human: 100%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.