PPIAL4G Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PPIAL4G Antibody is: synthetic peptide directed towards the C-terminal region of Human PPIAL4G. Synthetic peptide located within the following region: NGSQFFICTAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKIT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	18 kDa
Gene Name	peptidylprolyl isomerase A like 4G
Database Link	NP_001116540 Entrez Gene 644591 Human UniProt ID P0DN37
Background	PPIAL4G is a PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Synonyms	COAS-2
Note	Immunogen sequence homology: Human: 100%; Rat: 86%; Dog: 85%; Pig: 85%; Goat: 85%; Horse: 85%; Mouse: 85%; Sheep: 85%; Bovine: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.