H2BW2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-H2BFM Antibody is: synthetic peptide directed towards the middle region of Human H2BFM. Synthetic peptide located within the following region: SCYLMAAASAMAEASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	H2B histone family member M
Database Link	NP_001157888 Entrez Gene 286436 Human UniProt ID P0C1H6
Background	H2BFM is a core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Synonyms	1700014N06Rik; H2bfw; H2bl2; RP23-389M3.2
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Pathways	Systemic lupus erythematosus

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.