C3orf26 Rabbit Antibody

Specifications

Product Data
Reactivity	Human, Rat, Dog, Pig, Rabbit, Mouse
Host	Rabbit
Immunogen	The immunogen for Anti-C3orf26 Antibody is: synthetic peptide directed towards the N-terminal region of Human C3orf26. Synthetic peptide located within the following region: EASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTR
Isotype	IgG
Formulation	Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Database Link	NP_001161396 Entrez Gene 84319 Human
Background	The function of this protein remains unknown.
Synonyms	C3orf26
Note	Immunogen sequence homology: Human: 100%; Rat: 86%; Dog: 81%; Pig: 81%; Rabbit: 81%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.