C3orf32 (SSUH2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C3orf32 Antibody is: synthetic peptide directed towards the middle region of Human C3orf32. Synthetic peptide located within the following region: GRYKCSGCHGAGTVRCPSCCGAKRKAKQSRRCQLCAGSGRRRCSTCSGRG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	ssu-2 homolog (C. elegans)
Database Link	NP_001243677 Entrez Gene 51066 Human UniProt ID Q9Y2M2
Background	The function of this protein remains unknown.
Synonyms	C3orf32; fls485; SSU-2
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.