PLRG1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PLRG1 Antibody: synthetic peptide directed towards the N terminal of human PLRG1. Synthetic peptide located within the following region: YGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	pleiotropic regulator 1
Database Link	NP_002660 Entrez Gene 5356 Human UniProt ID O43660
Background	PLRG1 is necessary for spliceosome assembly and for pre-mRNA splicing.
Synonyms	Cwc1; PRL1; PRP46; PRPF46; TANGO4
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 92%; Horse: 92%; Bovine: 85%; Dog: 83%
Reference Data
Protein Families	Transcription Factors
Protein Pathways	Spliceosome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.