PITX3 Rabbit Polyclonal Antibody

CAT#: TA332080

Rabbit Polyclonal Anti-PITX3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (2)
Transient overexpression lysate of paired-like homeodomain 3 (PITX3)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-PITX3 Antibody: synthetic peptide directed towards the middle region of human PITX3. Synthetic peptide located within the following region: YEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSVNVGPLASQPVFSPPSS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 32 kDa
Gene Name paired like homeodomain 3
Background PITX3 is a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family act as transcription factors. Mutations of PITX3 have been associated with anterior segment mesenchymal dysgenesis (ASMD) and congenital cataracts. PITX3 is involved in lens formation during eye development.This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family act as transcription factors. Mutations of this gene have been associated with anterior segment mesenchymal dysgenesis (ASMD) and congenital cataracts. This protein is involved in lens formation during eye development. This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family act as transcription factors. This protein is involved in lens formation during eye development. Mutations of this gene have been associated with anterior segment mesenchymal dysgenesis and congenital cataracts. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms ASMD; ASOD; CTPP4; CTRCT11; PTX3
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...