FARSLB (FARSB) Rabbit Polyclonal Antibody

CAT#: TA332058

Rabbit Polyclonal Anti-FARSB Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5200.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of phenylalanyl-tRNA synthetase, beta subunit (FARSB)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human phenylalanyl-tRNA synthetase, beta subunit (FARSB), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human phenylalanyl-tRNA synthetase, beta subunit (FARSB), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-FARSB Antibody is: synthetic peptide directed towards the N-terminal region of Human FARSB. Synthetic peptide located within the following region: EEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDVVLYKIDVPANR
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 65 kDa
Gene Name phenylalanyl-tRNA synthetase beta subunit
Background This gene encodes a highly conserved enzyme that belongs to the aminoacyl-tRNA synthetase class IIc subfamily. This enzyme comprises the regulatory beta subunits that form a tetramer with two catalytic alpha subunits. In the presence of ATP, this tetramer is responsible for attaching L-phenylalanine to the terminal adenosine of the appropriate tRNA. A pseudogene located on chromosome 10 has been identified.
Synonyms FARSLB; FRSB; HSPC173; PheHB; PheRS
Note Immunogen sequence homology: Human: 100%; Rat: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Goat: 86%; Bovine: 86%; Guinea pig: 79%
Reference Data
Protein Pathways Aminoacyl-tRNA biosynthesis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...