PNMA1 Rabbit Polyclonal Antibody
CAT#: TA332048
Rabbit Polyclonal Anti-PNMA1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PNMA1 Antibody: synthetic peptide directed towards the middle region of human PNMA1. Synthetic peptide located within the following region: LNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANH |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 40 kDa |
Gene Name | paraneoplastic Ma antigen 1 |
Database Link | |
Background | PNMA1 encodes a protein that is highly restricted to the brain and testis. Anti-PNMA1 reacts mainly with subnuclear elements (including the nucleoli) and to a lesser degree the cytoplasm. |
Synonyms | MA1 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 92%; Guinea pig: 92%; Mouse: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |