Nr0b1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Nr0b1 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Nr0b1. Synthetic peptide located within the following region: YIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	nuclear receptor subfamily 0, group B, member 1
Database Link	NP_031456 Entrez Gene 11614 Mouse UniProt ID Q61066
Background	Nr0b1 is an orphan nuclear receptor and a component of a cascade required for the development of the hypothalamic-pituitary-adrenal-gonadal axis. Nr0b1 acts as a coregulatory protein that inhibits the transcriptional activity of other nuclear receptors through heterodimeric interactions. Nr0b1 may also have a role in the development of the embryo and in the maintenance of embryonic stem cell pluripotency.
Synonyms	AHC; AHCH; AHX; DAX-1; DAX1; DSS; GTD; HHG; NROB1
Note	Immunogen sequence homology: Human: 100%; Pig: 92%; Rat: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%; Horse: 83%; Dog: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.