GCDH Rabbit Polyclonal Antibody
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Rat |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-Gcdh Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 49 kDa |
| Gene Name | glutaryl-CoA dehydrogenase |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | ACAD5; GCD |
| Note | Immunogen sequence homology: Human: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 92%; Pig: 86%; Guinea pig: 85%; Zebrafish: 79% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | Fatty acid metabolism, Lysine degradation, Metabolic pathways, Tryptophan metabolism |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
