PALD (PALD1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PALD1 Antibody is: synthetic peptide directed towards the N-terminal region of Human PALD1. Synthetic peptide located within the following region: FRRVLQKLQKDGHRECVIFCVREEPVLFLRADEDFVSYTPRDKQNLHENL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	94 kDa
Gene Name	phosphatase domain containing, paladin 1
Database Link	NP_055246 Entrez Gene 27143 Human UniProt ID Q9ULE6
Background	The function of this protein remains unknown.
Synonyms	KIAA1274; PALD
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Bovine: 100%; Dog: 86%; Pig: 86%; Guinea pig: 86%; Rat: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.