MICAL2 Rabbit Polyclonal Antibody
CAT#: TA331974
Rabbit Polyclonal Anti-MICAL2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MICAL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human MICAL2. Synthetic peptide located within the following region: GKFYCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 86 kDa |
Gene Name | microtubule associated monooxygenase, calponin and LIM domain containing 2 |
Database Link | |
Background | Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin. It acts by modifying actin subunits through the addition of oxygen to form methionine-sulfoxide, leading to promote actin filament severing and prevent repolymerization. |
Synonyms | MICAL-2; MICAL2PV1; MICAL2PV2 |
Note | Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Horse: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |