MICAL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MICAL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human MICAL2. Synthetic peptide located within the following region: GKFYCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	86 kDa
Gene Name	microtubule associated monooxygenase, calponin and LIM domain containing 2
Database Link	NP_055447 Entrez Gene 9645 Human UniProt ID O94851
Background	Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin. It acts by modifying actin subunits through the addition of oxygen to form methionine-sulfoxide, leading to promote actin filament severing and prevent repolymerization.
Synonyms	MICAL-2; MICAL2PV1; MICAL2PV2
Note	Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Horse: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.