TELO2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TELO2 Antibody is: synthetic peptide directed towards the C-terminal region of Human TELO2. Synthetic peptide located within the following region: LEDLMDELLEARSWLADVAEKDPDEDCRTLALRALLLLQRLKNRLLPPAS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	92 kDa
Gene Name	telomere maintenance 2
Database Link	NP_057195 Entrez Gene 9894 Human UniProt ID Q9Y4R8
Background	This gene encodes a protein that functions as an S-phase checkpoint protein in the cell cycle. The protein may also play a role in DNA repair.
Synonyms	CLK2; TEL2; YHFS
Note	Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92%; Dog: 85%; Bovine: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.