VCX3A Rabbit Polyclonal Antibody

CAT#: TA331914

Rabbit Polyclonal Anti-VCX3A Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of variable charge, X-linked 3A (VCX3A)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human variable charge, X-linked 3A (VCX3A), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human variable charge, X-linked 3A (VCX3A), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-VCX3A Antibody is: synthetic peptide directed towards the N-terminal region of Human VCX3A. Synthetic peptide located within the following region: KKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHEL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 20 kDa
Gene Name variable charge, X-linked 3A
Background This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit.
Synonyms VCX-8r; VCX-A; VCX3; VCX8R; VCXA
Note Immunogen sequence homology: Horse: 100%; Human: 100%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...