ARL6IP4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ARL6IP4 Antibody is: synthetic peptide directed towards the middle region of Human ARL6IP4. Synthetic peptide located within the following region: SSSSSSDGRKKRGKYKDKRRKKKKKRKKLKKKGKEKAEAQQVEALPGPSL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	ADP ribosylation factor like GTPase 6 interacting protein 4
Database Link	NP_057722 Entrez Gene 51329 Human UniProt ID Q66PJ3
Background	The function of this protein remains unknown.
Synonyms	SFRS20; SR-25; SRp25; SRrp37
Note	Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rat: 80%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.