CHRAC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CHRAC1 Antibody: synthetic peptide directed towards the N terminal of human CHRAC1. Synthetic peptide located within the following region: SINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	15 kDa
Gene Name	chromatin accessibility complex 1
Database Link	NP_059140 Entrez Gene 54108 Human UniProt ID Q9NRG0
Background	CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. [supplied by OMIM]
Synonyms	CHARC1; CHARC15; CHRAC-1; CHRAC-15; CHRAC15; YCL1
Note	Immunogen sequence homology: Human: 100%; Rat: 92%; Horse: 92%; Bovine: 92%; Dog: 85%; Pig: 85%; Mouse: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.