MTMR10 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MTMR10 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR10. Synthetic peptide located within the following region: PRRNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPANLHGVILPRVSGT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	88 kDa
Gene Name	myotubularin related protein 10
Database Link	NP_060232 Entrez Gene 54893 Human UniProt ID Q9NXD2
Background	MTMR10 is a probable pseudophosphatase. It contains a Glu residue instead of a conserved Cys residue in the dsPTPase catalytic loop which renders it catalytically inactive as a phosphatase.
Synonyms	FLJ20313
Note	Immunogen sequence homology: Human: 100%; Pig: 79%; Guinea pig: 79%; Horse: 77%; Mouse: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.