Spindly (SPDL1) Rabbit Polyclonal Antibody

CAT#: TA331882

Rabbit Polyclonal Anti-SPDL1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of coiled-coil domain containing 99 (CCDC99)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human coiled-coil domain containing 99 (CCDC99), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human coiled-coil domain containing 99 (CCDC99), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-CCDC99 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC99. Synthetic peptide located within the following region: PRLAAESKLQTEVKEGKETSSKLEKETCKKLHPILYVSSKSTPETQCPQQ
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 67 kDa
Gene Name spindle apparatus coiled-coil protein 1
Background CCDC99 is required for the localization of dynein and dynactin to the mitotic kintochore. Dynein is believed to control the initial lateral interaction between the kinetochore and spindle microtubules and to facilitate the subsequent formation of end-on kinetochore-microtubule attachments mediated by the NDC80 complex. CCDC99 is also required for correct spindle orientation. It does not appear to be required for the removal of spindle assembly checkpoint (SAC) proteins from the kinetochore upon bipolar spindle attachment.
Synonyms CCDC99
Note Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 92%; Rabbit: 86%; Rat: 79%; Bovine: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...