FOXJ2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FOXJ2 Antibody: synthetic peptide directed towards the middle region of human FOXJ2. Synthetic peptide located within the following region: SLQSPTSIASYSQGTGSVDGGAVAAGASGRESAEGPPPLYNTNHDFKFSY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	forkhead box J2
Database Link	NP_060886 Entrez Gene 55810 Human UniProt ID Q9P0K8
Background	FOXJ2 is a fork head factor that is expressed in many adult tissues. In the embryo, FOXJ2 expression showed a very early onset during the cleavage stages of preimplantation development. It is capable of activating transcription from promoters containing its sites
Synonyms	FHX
Note	Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 92%; Bovine: 92%; Guinea pig: 92%; Rat: 85%; Mouse: 85%; Rabbit: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.