TMEM176A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TMEM176A Antibody: synthetic peptide directed towards the N terminal of human TMEM176A. Synthetic peptide located within the following region: TCCSALRPRATQARGSSRLLVASWVMQIVLGILSAVLGGFFYIRDYTLLV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	transmembrane protein 176A
Database Link	NP_060957 Entrez Gene 55365 Human UniProt ID Q96HP8
Background	The function of this protein remains unknown.
Synonyms	GS188; HCA112; MS4B1
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.