PBXIP1 Rabbit Antibody
CAT#: TA331826
Rabbit Polyclonal Anti-PBXIP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Reactivity | Human |
Host | Rabbit |
Immunogen | The immunogen for Anti-PBXIP1 Antibody: synthetic peptide directed towards the N terminal of human PBXIP1. Synthetic peptide located within the following region: AGGEGAGGELGISLNMCLLGALVLLGLGVLLFSGGLSESETGPMEEVERQ |
Isotype | IgG |
Formulation | Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 81 kDa |
Database Link | |
Background | PBXIP1 is the regulator of pre-B-cell leukemia transcription factors (BPXs) function. It inhibits the binding of PBX1-HOX complex to DNA and blocks the transcriptional activity of E2A-PBX1. PBXIP1 tethers estrogen receptor-alpha (ESR1) to microtubules and allows them to influence estrogen receptors-alpha signaling. |
Synonyms | HPIP |
Note | Immunogen sequence homology: Human: 100%; Mouse: 92%; Bovine: 92%; Rat: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |