ZNF537 (TSHZ3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF537 Antibody: synthetic peptide directed towards the middle region of human ZNF537. Synthetic peptide located within the following region: LNVEVKKEVDKEKAVTDEKPKQKDKPGEEEEKCDISSKYHYLTENDLEES
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	98 kDa
Gene Name	teashirt zinc finger homeobox 3
Database Link	NP_065907 Entrez Gene 57616 Human UniProt ID Q63HK5
Background	The ZNF537 gene is located on chromosome 19.
Synonyms	TSH3; ZNF537
Note	Immunogen sequence homology: Human: 100%; Rat: 86%; Horse: 86%; Mouse: 85%; Pig: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.