DCDC5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DCDC5 Antibody is: synthetic peptide directed towards the N-terminal region of Human DCDC5. Synthetic peptide located within the following region: KTTEPYAPVRLRVLQNGEKNKNRSVTILGPDISPGRKTQCTEILNLPSAA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	71 kDa
Gene Name	doublecortin domain containing 5
Database Link	NP_065920 Entrez Gene 341019 HumanEntrez Gene 100506627 Human
Background	The function of this protein remains unknown.
Synonyms	DKFZp779D068; FLJ44078; FLJ46154; KIAA1493; MGC190499; MGC190811
Note	Immunogen sequence homology: Human: 100%; Rabbit: 82%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.