EPS15R (EPS15L1) Rabbit Polyclonal Antibody
CAT#: TA331793
Rabbit Polyclonal Anti-EPS15L1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-EPS15L1 Antibody is: synthetic peptide directed towards the C-terminal region of Human EPS15L1. Synthetic peptide located within the following region: GFSDDPFKSKQDTPALPPKKPAPPRPKPPSGKSTPVSQLGSADFPEAPDP |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 95 kDa |
| Gene Name | epidermal growth factor receptor pathway substrate 15 like 1 |
| Database Link | |
| Background | EPS15L1 seems to be a constitutive component of clathrin-coated pits that is required for receptor-mediated endocytosis. |
| Synonyms | EPS15R |
| Note | Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 86%; Guinea pig: 86% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
