BACH2 Rabbit Polyclonal Antibody
CAT#: TA331784
Rabbit Polyclonal Anti-BACH2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5200.00
CNY 4840.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-BACH2 Antibody: synthetic peptide directed towards the middle region of human BACH2. Synthetic peptide located within the following region: TSGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDY |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 92 kDa |
| Gene Name | BTB domain and CNC homolog 2 |
| Database Link | |
| Background | BACH2 belongs to the bZIP family. It is a transcriptional regulator that acts as repressor or activator. The protein binds to Maf recognition elements (MARE) and play important roles in coordinating transcription activation and repression by MAFK. |
| Synonyms | BTBD25 |
| Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Dog: 85% |
| Reference Data | |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
