SEMA4A Rabbit Polyclonal Antibody
CAT#: TA331773
Rabbit Polyclonal Anti-SEMA4A Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SEMA4A Antibody: synthetic peptide directed towards the N terminal of human SEMA4A. Synthetic peptide located within the following region: PSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 84 kDa |
Gene Name | semaphorin 4A |
Database Link | |
Background | SEMA4A is a member of the semaphorin family of soluble and transmembrane proteins. Semaphorins are involved in guidance of axonal migration during neuronal development and in immune responses. |
Synonyms | CORD10; RP35; SEMAB; SEMB |
Note | Immunogen sequence homology: Human: 100%; Mouse: 100%; Rabbit: 93%; Pig: 91%; Dog: 86%; Rat: 86%; Horse: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Axon guidance |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |