PCYOX1L Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PCYOX1L Antibody is: synthetic peptide directed towards the C-terminal region of Human PCYOX1L. Synthetic peptide located within the following region: ANILTTDFPSFFCTLDNICPVNISASFRRKQPQEAAVWRVQSPKPLFRTQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	prenylcysteine oxidase 1 like
Database Link	NP_076933 Entrez Gene 78991 Human UniProt ID Q8NBM8
Background	PCYOX1L is a probable oxidoreductase.
Synonyms	MGC3265
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Zebrafish: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.