PYROXD1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PYROXD1 Antibody is: synthetic peptide directed towards the N-terminal region of Human PYROXD1. Synthetic peptide located within the following region: IESGVKQLKSEEHCIVTEDGNQHVYKKLCLCAGAKPKLICEGNPYVLGIR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	pyridine nucleotide-disulphide oxidoreductase domain 1
Database Link	NP_079130 Entrez Gene 79912 Human UniProt ID Q8WU10
Background	The function of this protein remains unknown.
Synonyms	FLJ22028
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Bovine: 92%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.