Ccdc59 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Ccdc59 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ccdc59. Synthetic peptide located within the following region: KRAAKKFEFEMRKQEREEAQRLYKKKKMEAFKILSKKTKKGQPNLNLQME
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	coiled-coil domain containing 59
Database Link	NP_079878 Entrez Gene 52713 Mouse UniProt ID Q8R2N0
Background	Ccdc59 is a component of the transcription complexes of the pulmonary surfactant-associated protein-B (SFTPB) and -C (SFTPC). It enhances homeobox protein Nkx-2.1-activated SFTPB and SFTPC promoter activities.
Synonyms	BR22; DKFZp686K1021; FLJ10294; HSPC128; TAP26
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Mouse: 92%; Guinea pig: 91%; Rabbit: 86%; Dog: 85%; Yeast: 82%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.