CYP2S1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CYP2S1 Antibody: synthetic peptide directed towards the C terminal of human CYP2S1. Synthetic peptide located within the following region: MKYPHVQKWVREELNRELGAGQAPSLGDRTRLPYTDAVLHEAQRLLALVP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	cytochrome P450 family 2 subfamily S member 1
Database Link	NP_085125 Entrez Gene 29785 Human UniProt ID Q96SQ9
Background	CYP2S1 has a potential importance for extrahepatic xenobiotic metabolism.
Synonyms	CYPIIS1
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 90%; Goat: 83%; Sheep: 83%; Horse: 82%; Guinea pig: 82%
Reference Data
Protein Families	Druggable Genome, P450, Transmembrane
Protein Pathways	Metabolism of xenobiotics by cytochrome P450

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.