FAM117A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM117A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM117A. Synthetic peptide located within the following region: SPRPNHSYIFKREPPEGCEKVRVFEEATSPGPDLAFLTSCPDKNKVHFNP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	family with sequence similarity 117 member A
Database Link	NP_110429 Entrez Gene 81558 Human UniProt ID Q9C073
Background	The function of this protein remains unknown.
Synonyms	C; EBP-induced protein; EBP induced protein; family with sequence similarity 117; member A
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Zebrafish: 93%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.