RNF87 (TRIM4) Rabbit Polyclonal Antibody

CAT#: TA331688

Rabbit Polyclonal Anti-TRIM4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of tripartite motif-containing 4 (TRIM4), transcript variant beta
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human tripartite motif-containing 4 (TRIM4), transcript variant beta, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human tripartite motif-containing 4 (TRIM4), transcript variant beta, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-TRIM4 Antibody: synthetic peptide directed towards the N terminal of human TRIM4. Synthetic peptide located within the following region: LVCRESQEHQTHAMAPIDEAFESYRTGNFDIHVDEWKRRLIRLLLYHSKQ
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 57 kDa
Gene Name tripartite motif containing 4
Background TRIM4 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its function has not been identified.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its function has not been identified. Alternative splicing of this gene generates two transcript variants.
Synonyms RNF87
Note Immunogen sequence homology: Human: 100%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...