HDHD5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CECR5 Antibody is: synthetic peptide directed towards the C-terminal region of Human CECR5. Synthetic peptide located within the following region: SQSCISILVCTGVYNPRNPQSTEPVLGGGEPPFHGHRDLCFSPGLMEASH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	cat eye syndrome chromosome region, candidate 5
Database Link	NP_149061 Entrez Gene 27440 Human UniProt ID Q9BXW7
Background	The function of this protein remains unknown.
Synonyms	candidate 5; cat eye syndrome chromosome region
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.