SNX18 Rabbit Polyclonal Antibody
CAT#: TA331679
Rabbit Polyclonal Anti-SNX22 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 4840.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SNX22 Antibody is: synthetic peptide directed towards the N-terminal region of Human SNX22. Synthetic peptide located within the following region: LEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALH |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 13 kDa |
Gene Name | sorting nexin 18 |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | SH3PX2; SH3PXD3B; SNAG1 |
Note | Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 85%; Pig: 85%; Guinea pig: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |