PEX11C (PEX11G) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PEX11G Antibody is: synthetic peptide directed towards the C-terminal region of Human PEX11G. Synthetic peptide located within the following region: LANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMYQAARAGGQAEATTP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	peroxisomal biogenesis factor 11 gamma
Database Link	NP_542393 Entrez Gene 92960 Human UniProt ID Q96HA9
Background	The protein encoded by this gene is a member of the PEX11 family. This family is reported to regulate the number and size of peroxisomes in evolutionarily distant organisms. The protein encoded by this gene may induce clustering of peroxisomes. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Synonyms	MGC4281
Note	Immunogen sequence homology: Human: 100%; Rabbit: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.