SMCR7 (MIEF2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SMCR7 Antibody is: synthetic peptide directed towards the N-terminal region of Human SMCR7. Synthetic peptide located within the following region: IDRATSPRDEDDTKADSWKELSLLKATPHLQPRPPPAALSQPVLPLAPSS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	mitochondrial elongation factor 2
Database Link	NP_683684 Entrez Gene 125170 Human UniProt ID Q96C03
Background	This gene encodes an outer mitochondrial membrane protein that functions in the regulation of mitochondrial morphology. It can directly recruit the fission mediator dynamin-related protein 1 (Drp1) to the mitochondrial surface. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing results in multiple transcript variants encoding different isoforms.
Synonyms	MID49; SMCR7
Note	Immunogen sequence homology: Human: 100%; Bovine: 92%; Rat: 86%; Mouse: 86%; Dog: 85%; Pig: 79%; Guinea pig: 79%; Horse: 77%; Rabbit: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.