ZNF441 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF441 Antibody: synthetic peptide directed towards the N terminal of human ZNF441. Synthetic peptide located within the following region: MVERACEIKDNSQCGGPFTQTQDSIVNEKIPGVDPWESSECTDVLMGRSS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	zinc finger protein 441
Database Link	NP_689568 Entrez Gene 126068 Human UniProt ID Q8N8Z8
Background	ZNF441 contains 19 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. It may be involved in transcriptional regulation.
Synonyms	FLJ38637
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.