PM20D1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PM20D1 Antibody is: synthetic peptide directed towards the N-terminal region of Human PM20D1. Synthetic peptide located within the following region: SMGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEKSNTT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	peptidase M20 domain containing 1
Database Link	NP_689704 Entrez Gene 148811 Human UniProt ID Q6GTS8
Background	The function of this protein remains unknown.
Synonyms	Cps1
Note	Immunogen sequence homology: Human: 100%; Pig: 91%; Guinea pig: 91%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.