DYNLT5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TCTEX1D1 Antibody is: synthetic peptide directed towards the N-terminal region of Human TCTEX1D1. Synthetic peptide located within the following region: KKRGSISSLSNHEFWRKEIHGRIKDSMSTVSYMEEPSQRDDISRLTVQME
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	19 kDa
Gene Name	Tctex1 domain containing 1
Database Link	NP_689878 Entrez Gene 200132 Human UniProt ID Q8N7M0
Background	The function of this protein remains unknown.
Synonyms	RP11-266I14.2
Note	Immunogen sequence homology: Human: 100%; Rabbit: 86%; Pig: 79%; Rat: 79%; Guinea pig: 79%; Dog: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.