DEFB119 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DEFB119 Antibody is: synthetic peptide directed towards the N-terminal region of Human DEFB119. Synthetic peptide located within the following region: LLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	9 kDa
Gene Name	defensin beta 119
Database Link	NP_695021 Entrez Gene 245932 Human UniProt ID Q8N690
Background	This gene encodes a member of a family of small secreted proteins. These proteins participate in immune defense against microbial infection. This gene is located in a cluster of similar genes on chromosome 20. Alternative splicing results in multiple transcript variants.
Synonyms	DEFB-19; DEFB-20; DEFB20; DEFB120; ESC42-RELA; ESC42-RELB
Note	Immunogen sequence homology: Human: 100%; Pig: 92%; Horse: 92%; Rat: 85%; Guinea pig: 82%; Dog: 77%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.