DIPK2B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CXorf36 Antibody is: synthetic peptide directed towards the N-terminal region of Human CXorf36. Synthetic peptide located within the following region: GLDKCNACIGTSICKKFFKEEIRSDNWLASHLGLPPDSLLSYPANYSDDS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	chromosome X open reading frame 36
Database Link	NP_789789 Entrez Gene 79742 Human UniProt ID Q9H7Y0
Background	The function of this protein remains unknown.
Synonyms	4930578C19Rik; bA435K1.1; DIA1R; EPQL1862; PRO3743
Note	Immunogen sequence homology: Human: 100%; Pig: 92%; Bovine: 92%; Dog: 86%; Horse: 86%; Mouse: 86%; Rat: 79%; Rabbit: 79%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.