MPRA Rabbit Antibody

Specifications

Product Data
Reactivity	Human, Rat, Mouse, Horse, Guinea pig
Host	Rabbit
Immunogen	The immunogen for Anti-PAQR7 Antibody is: synthetic peptide directed towards the C-terminal region of Human PAQR7. Synthetic peptide located within the following region: YEARRPIYEPLHTHWPHNFSGLFLLTVGSSILTAFLLSQLVQRKLDQKTK
Isotype	IgG
Formulation	Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Database Link	NP_848509 Entrez Gene 164091 Human
Background	PAQR7 is a steroid membrane receptor. It binds progesterone in vitro and may be involved in oocyte maturation.
Synonyms	MPRA; mSR; PGLP
Note	Immunogen sequence homology: Human: 100%; Rat: 86%; Mouse: 86%; Horse: 85%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.