RTN4RL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RTN4RL1 Antibody is: synthetic peptide directed towards the C-terminal region of Human RTN4RL1. Synthetic peptide located within the following region: RPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	reticulon 4 receptor like 1
Database Link	NP_848663 Entrez Gene 146760 Human UniProt ID Q86UN2
Background	RTN4RL1 may play a role in regulating axonal regeneration and plasticity in the adult central nervous system.
Synonyms	NgR3; NGRH2
Note	Immunogen sequence homology: Human: 100%; Bovine: 86%; Dog: 79%; Pig: 79%; Horse: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.