GPR141 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GPR141 Antibody is: synthetic peptide directed towards the middle region of Human GPR141. Synthetic peptide located within the following region: DKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	G protein-coupled receptor 141
Database Link	NP_861456 Entrez Gene 353345 Human UniProt ID Q7Z602
Background	GPR141 is a member of the rhodopsin family of G protein-coupled receptors (GPRs).
Synonyms	PGR13
Note	Immunogen sequence homology: Human: 100%; Rabbit: 89%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.