LONRF2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LONRF2 Antibody: synthetic peptide directed towards the middle region of human LONRF2. Synthetic peptide located within the following region: IGISRFRVLSHRHRDGYNTADIEYLEDEKVEGPEYEELAALHDSVHQQSV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	84 kDa
Gene Name	LON peptidase N-terminal domain and ring finger 2
Database Link	NP_940863 Entrez Gene 164832 Human UniProt ID Q1L5Z9
Background	LONRF2 contains 1 Lon domain,1 RING-type zinc finger and 6 TPR repeats. The function of the LONRF2 protein remains unknown.
Synonyms	RNF192
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 90%; Rabbit: 90%; Guinea pig: 90%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.