MAP4K5 Rabbit Polyclonal Antibody
CAT#: TA331516
Rabbit Polyclonal Anti-MAP4K5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MAP4K5 Antibody is: synthetic peptide directed towards the C-terminal region of Human MAP4K5. Synthetic peptide located within the following region: KSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILAGHENS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 95 kDa |
Gene Name | mitogen-activated protein kinase kinase kinase kinase 5 |
Database Link | |
Background | MAP4K5 may play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway. |
Synonyms | GCKR; KHS; KHS1; MAPKKKK5 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 93% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |